SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385818099|ref|YP_005854489.1| from Lactobacillus amylovorus GRL1118

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385818099|ref|YP_005854489.1|
Domain Number 1 Region: 1-190
Classification Level Classification E-value
Superfamily Formyltransferase 4.19e-55
Family Formyltransferase 0.000019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385818099|ref|YP_005854489.1|
Sequence length 198
Comment phosphoribosyl glycinamide formyltransferase [Lactobacillus amylovorus GRL1118]
Sequence
MRVAILASGNGTNFEALTKQFQAGEIPGIEALMFCNHPNAPVIKRAERLGVPYETFSVKE
CGGKDAYEKRLLKVLQDYQIDFIVLSGYLRVVGPTILNEYPNSIINLHPALLPKYPGLNS
IERAFDDYKKGKIKETGVTVHFIDAHLDHGPIIAQQAVPIYPDDTVDTLEARVHETEHKL
FPATLRKVLSQIMEKEEN
Download sequence
Identical sequences F2M1T3
gi|385818099|ref|YP_005854489.1| WP_014566079.1.76767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]