SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385817195|ref|YP_005853585.1| from Lactobacillus amylovorus GRL1118

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385817195|ref|YP_005853585.1|
Domain Number 1 Region: 213-353
Classification Level Classification E-value
Superfamily CBS-domain pair 5.56e-31
Family CBS-domain pair 0.0015
Further Details:      
 
Domain Number 2 Region: 357-437
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 0.00000000000327
Family CorC/HlyC domain-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385817195|ref|YP_005853585.1|
Sequence length 453
Comment transporter [Lactobacillus amylovorus GRL1118]
Sequence
MSTAQIVTNLVATVLIFIVASFFVAAEFALVQTRPSQLEDMLAKGQGNKKKLQRALHMTH
NLNEYLSTTQVGTTLVGVVLGWFSADTFAVILEDLFHLTPMSESLIKSVSAILGVILLTY
LEVVLTEVVPKNIAIDKPVGMMMMIVTPLHIFHTIVYPFVWLLNTSSNGILKLMGFAPAD
EENEVYSQSEIIKLSRNAVHGGSLDKEDLTYMERAFELNDKIAKDIMTDRTRLSVLDSTD
TIAYALKKYLEEGYSRFPVVRDNDKDDVVGYVYAYDIVQQSQIDAKVPVTRIIRTIITVP
ESMPIQDILHLMISKHTPVVLVVDEYGGTSGIVTDKDIYEELFGSVKDEIDDVSDDYIIK
DKEGNVHVSGKTTLYDFERYFHTDLKAFQDSDIITIGGYMMEHYPNLKKGESVELEGYKF
VLDSIEQGFMRWFIVKPIKKNKKADSDQSKTEK
Download sequence
Identical sequences F2LYA5
WP_014565662.1.76767 gi|385817195|ref|YP_005853585.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]