SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385817217|ref|YP_005853607.1| from Lactobacillus amylovorus GRL1118

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385817217|ref|YP_005853607.1|
Domain Number 1 Region: 57-197
Classification Level Classification E-value
Superfamily CBS-domain pair 3.79e-28
Family CBS-domain pair 0.0036
Further Details:      
 
Domain Number 2 Region: 198-277
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 3e-16
Family CorC/HlyC domain-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385817217|ref|YP_005853607.1|
Sequence length 288
Comment transporter protein -hemolysin [Lactobacillus amylovorus GRL1118]
Sequence
MSSDPGADNFFDRLKNKLSGDKKEETKDHLEKEIVNLHDSHKIDDKEFSMLEGILEFQGK
TAREVMVPRTDAFMVDAEVSLQDNLDEILREPYSRVPVYKRDKDKIVGVIHIRSVLRMAK
QKGFENLDYEDVMIEPLFALETAELGDLLMEMQQTQRQLAILMDEYGGVTGLATIEDLVE
EIVGDIDDEVDHTEVLYNQIAPHKYIIYGKMPLDEFNEQFGTHLEMEDVDTVAGYVINTL
KVIPAKGEKLTVDIGDGKTLTTRRMKGSRLLTVLLSEDGLKKEEDKKD
Download sequence
Identical sequences E4SMQ9 F2LYC7
gi|385817217|ref|YP_005853607.1| gi|315037862|ref|YP_004031430.1| WP_013437441.1.47126 WP_013437441.1.62722 WP_013437441.1.76767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]