SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YOR291W from Saccharomyces cerevisiae CLIB324

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR291W
Domain Number 1 Region: 457-552,676-773
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 2.75e-36
Family Calcium ATPase, transmembrane domain M 0.021
Further Details:      
 
Domain Number 2 Region: 774-790,980-1069,1147-1213
Classification Level Classification E-value
Superfamily HAD-like 1.9e-29
Family Meta-cation ATPase, catalytic domain P 0.0044
Further Details:      
 
Domain Number 3 Region: 552-678
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 4.97e-19
Family Calcium ATPase, transduction domain A 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YOR291W
Sequence length 1235
Comment YPK9 ORF Verified Vacuolar protein with a possible role in sequestering heavy metals; has similarity to the type V P-type ATPase Spf1p; homolog of human ATP13A2 (PARK9), mutations in which are associated with Parkinson disease and Kufor-Rakeb syndrome
Sequence
MDIPSSNQIQHGQRSERNRRMPRASFSSTATTSTAATLTSAMVLDQNNSEPYAGATFEAV
PSSIVSFHHPHSFQSSNLPSPHSSGNLEQRGRRLTESEPLVLSSAEQSRSSSRNPSHFRF
FTQEQISNAEGASTLENTDYDMAWDATPAYEQDRIYGTGPSSRRSSIRSFSRASSLSNAK
SYGSFSKRGRSGSRAPQRLGENSDTGFVYHSATHSSSSLSRYTTRERIPIELESQTDEIL
EDESSTHSLESSDSRRSASENNRGSFSGHDDVHNQHSEYLKPDYHEKFYPQYAPNLHYQR
FYIAEEDLVIGIAAYQTSKFWYIIYNLCCFLTFGLVYLLTRWLPHLKVKFYGVKVPLAKA
EWVVIENEFGEFVIQPIDRQWYNRPLSTVLPFENYPNPSYEPNDINLSHHHANEINPNVP
ILITFEYRYIKFIYSPLDDLFKTNNNWIDPDWVDLSTVSNGLTKGVQEDRELAFGKNQIN
LRMKTTSEILFNEVLHPFYVFQVFSIILWGIDEYYYYAACIFLISVLSIFDSLNEQKKVS
RNLAEMSHFHCDVRVLRDKFWTTISSSELVPGDIYEVSDPNITILPCDSILLSSDCIVNE
SMLTGESVPVSKFPATEETMYQLCDDFQSTQISSFVSKSFLYNGTNIIRARIAPGQTAAL
AMVVRTGFSTTKGSLVRSMVFPKPTGFKFYRDSFKYIGFMSLIAIFGFCVSCVQFIKLGL
DKKTMILRALDIITIVVPPALPATLTIGTNFALSRLKEKGIFCISPTRLNISGKIDVMCF
DKTGTLTEDGLDVLGVQISEPNGVRGQKFGELLSDIRQVFPKFSLNDCSSPLDFKSRNFF
MSLLTCHSLRSVDGNLLGDPLDFKMFQFTGWSFEEDFQKQAFHSLYEGRHEDDVFPENSE
IIPAVVHPDSNNRENTFTDNDPHNFLGVVRSFEFLSELRRMSVIVKTNNDDVYWSFTKGA
PEVISEICNKSTLPADFEEVLRCYTHNGYRVIACAGKTLPKRTWLYSQKVSREEVESNLE
FLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSI
NDTPLHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVFRLLFR
DENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGANDCGALKAADV
GISLSEAEASVAAPFTSRYLILAAYLMSLGKGVLR
Download sequence
Identical sequences YOR291W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]