SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YJL127C from Saccharomyces cerevisiae CLIB382

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL127C
Domain Number 1 Region: 99-213
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000000167
Family N-acetyl transferase, NAT 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YJL127C
Sequence length 566
Comment SPT10 ORF Verified Putative histone acetylase with a role in transcriptional silencing, sequence-specific activator of histone genes, binds specifically and cooperatively to pairs of UAS elements in core histone promoters, functions at or near the TATA box
Sequence
MYPIPAYPDLLPLGLLNFLLDEFNMEVEKGDSFPYYETLSLEEFKNVWFHNDGHVCIMVL
GEIPELDYSMDTEADTDDNFGTEIETTKHTTQYKKRKERRNLNLSIQWEKQCLGIFDLKP
AYPGRSAHVVTGTFLVNAGIRGKGIGKTLVETFIEWSKKLGFTSSFFPLIYGTNVGIRRI
LEGLNFRRIGKLPEAGILKGFDVPVDSFMYGKEFTHITKSIDLLRDPQKSIEIGKYERLK
HFLETGKYPLHCDRNEKARLRVLSKTHSVLNGKLMTKGKEIIYDTDQQIQIALEIHLMEH
LGINKVTSKIGEKYHWRGIKSTVSEVISRCQKCKMRYKDGTGVIIEQKRAVKQAHMLPTQ
HIETINNPRKSKKHDNALLGQAINFPQNIISSTLNDVEGEPTPPDTNIVQPTFQNATNSP
ATTAEANEANKRSEFLSSIQSTPLLDDEQSMNSFNRFVEEENSRKRRKYLDVASNGIVPH
LTNNESQDHANPVNRDERDMNHSVPDLDRNDHTIMNDAMLSLEDNVMAALEMVQKEQQQK
INHRGEDVTGQQIDLNNSEGNENSVT
Download sequence
Identical sequences YJL127C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]