SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YOR013W from Saccharomyces cerevisiae CLIB382

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YOR013W
Domain Number - Region: 24-65
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0244
Family N-acetyl transferase, NAT 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YOR013W
Sequence length 105
Comment IRC11 ORF Dubious Dubious opening reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps the uncharacterized gene YOR012C; null mutant displays increased levels of spontaneous Rad52 foci
Sequence
MPLGMDYYYLYAIGKDPSHPEIRGSVRKILEKYKTKADKANCALALEAISEHARSVYEYF
GFKTYLVFQLGVGEVNSKGEPDPQGKGFTAYLMLYHKDADTIFHA
Download sequence
Identical sequences YOR013W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]