SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YPR118W from Saccharomyces cerevisiae FL100

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR118W
Domain Number 1 Region: 5-406
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 7.2e-119
Family IF2B-like 0.000000000000789
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YPR118W
Sequence length 411
Comment MRI1 ORF Verified 5'-methylthioribose-1-phosphate isomerase; catalyzes the isomerization of 5-methylthioribose-1-phosphate to 5-methylthioribulose-1-phosphate in the methionine salvage pathway
Sequence
MSLEAIVFDRSEPENVSVKVLDQLLLPYTTKYVPIHTIDDGYSVIKSMQVRGAPAIAIVG
SLSVLTEVQLIKHNPTSDVATLYSLVNWESTKTVLNKRLDFLLSSRPTAVNLSNSLVEIK
NILKSSSDLKAFDGSLYNYVCELIDEDLANNMKMGDNGAKYLIDVLQKDGFKDEFAVLTI
CNTGSLATSGYGTALGVIRSLWKDSLAKTDKADSGLDNEKCPRMGHVFPLETRPYNQGSR
LTAYELVYDKIPSTLITDSSIAYRIRTSPIPIKAAFVGADRIVRNGDTANKIGTLQLAVI
CKQFGIKFFVVAPKTTIDNVTETGDDIIVEERNPEEFKVVTGTVINPENGSLILNESGEP
ITGKVGIAPLEINVWNPAFDITPHELIDGIITEEGVFTKNSSGEFQLESLF
Download sequence
Identical sequences A6ZWZ9 B3LK82 B5VTQ8 C8ZJE0 E7M171 E7NP13 N1P2B9 Q06489
YPR118W YPR118W YPR118W YPR118W YPR118w___KOG1468 YPR118W YPR118W NP_015443.1.97178 YPR118W YPR118W YPR118W YPR118W YPR118W YPR118W YPR118W 4932.YPR118W YPR118W tr|A6ZWZ9|A6ZWZ9_YEAS7 YPR118W SCRT_02596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]