SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si000099m|PACid:19676683 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si000099m|PACid:19676683
Domain Number 1 Region: 675-734,972-1153
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.27e-34
Family Tandem AAA-ATPase domain 0.0027
Further Details:      
 
Domain Number 2 Region: 266-293,332-357
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000019
Family Tandem AAA-ATPase domain 0.079
Further Details:      
 
Domain Number 3 Region: 231-267
Classification Level Classification E-value
Superfamily F-box domain 0.00000116
Family F-box domain 0.0054
Further Details:      
 
Weak hits

Sequence:  Si000099m|PACid:19676683
Domain Number - Region: 890-937
Classification Level Classification E-value
Superfamily RING/U-box 0.000903
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si000099m|PACid:19676683
Sequence length 1185
Sequence
MDAAAAAAARRKLGGYLRAVLSVDVAGAASIPPLSRCTLSACGAVPLAPLPDEGTTPRSK
WRASAGGGGGSVVRMLRTLVANRCVEVEGTLLRVVTRSAGVGDGVVVEARAVVLIDVYLP
VAAWSGWQFPRSRTAAAAVFKHVSCNWDARKALLAFDWAAHDGPHCDDHCIWSCTDCHVL
GCEDHQIASISNKEKSFDLHEIFKTLPGVRMEKGMQTERIIPDAETLELGIWSVPDDVLN
KVLILLKPRDLIRVAATCHHLRSLAASIMPCMKLKLFPHQEAAVEWMLRREQNTQVLAHP
LYKDFCTEDGFPFYINVTSGEVSTGNSPTINDFRGGMFCDEPGLGKTVTTLSLILKTHGT
LAYPPQGVDVSWCMHKPDKKYGYYELSPSCSSNRNSSSSVSKKLLREDVTTDDPCSSGLS
HDDDPVCSTRSSRKRGRLLSPDPTKVMFHATSEKSPSSSHSKVHPTPATHVLKFTKNSRQ
VRKNLMDAYSNGSVGNKRKRGTTSETNETWVQCDACRKWRRLSDATVLDSTTAWFCTMNT
DPTRQKCTAPEESWDFVKKITNLPGFYKKNSLPGNEENVSFFTNILKDNVAMINSETKKA
LIWLAKLSPSKLVEMELVGLTRPVLDTRATTGKGARPYYKIFQAFGLVRKIEKGVTRCRL
SAEWGPQKRSALKHVHWFRVILDEGHTLGSSLALTNKLQMAVALVASNRWILTGTPTPNT
PTSQVAHLHPMLKFLHDEVYGQNYQSWDSGIHRPFEAQMEEGRVRLVQLLQRTMISARKA
DLKNIPPCIKKITFLDFNEGHAKSYNELVVTIRRNILMADWNDPSHVESLLNPKQWKFRA
TTIKNVRLSCCVAGHIKVAEAGQDIQETMDDLVKLGLDPSSDEYQFIRIALLNGASCFRC
KVWCRLPIITPCQHILCLDCVALDSEKCTLPGCGNHYEMQTPAVRLENPKPKWPVPKDLI
ELQPSYKQDDWDPDWQSTSSSKVSYLVDKLISLRETYMNHGNNITNSAGHANALSCQPQA
MLDKVIIFSQFLEHIHVIEQQLTIAGITYAGMYSPMPLGSKRSALTKFQEDPTCMALVMD
GTAALGLDLSFVTHVFLMEPIWDRSMEEQVISRAHRMGATRPILVETLAMRGTIEEQMLK
LLQDSSACRKMVNKGISSTENEGGRPHRSLHDFAESSYLAQLSFV
Download sequence
Identical sequences K3XDY2
Si000099m|PACid:19676683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]