SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si000138m|PACid:19676684 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si000138m|PACid:19676684
Domain Number 1 Region: 675-734,972-1059
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000101
Family Tandem AAA-ATPase domain 0.033
Further Details:      
 
Domain Number 2 Region: 266-293,332-357
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000199
Family Tandem AAA-ATPase domain 0.079
Further Details:      
 
Domain Number 3 Region: 231-267
Classification Level Classification E-value
Superfamily F-box domain 0.000000968
Family F-box domain 0.0054
Further Details:      
 
Weak hits

Sequence:  Si000138m|PACid:19676684
Domain Number - Region: 890-937
Classification Level Classification E-value
Superfamily RING/U-box 0.000707
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si000138m|PACid:19676684
Sequence length 1069
Sequence
MDAAAAAAARRKLGGYLRAVLSVDVAGAASIPPLSRCTLSACGAVPLAPLPDEGTTPRSK
WRASAGGGGGSVVRMLRTLVANRCVEVEGTLLRVVTRSAGVGDGVVVEARAVVLIDVYLP
VAAWSGWQFPRSRTAAAAVFKHVSCNWDARKALLAFDWAAHDGPHCDDHCIWSCTDCHVL
GCEDHQIASISNKEKSFDLHEIFKTLPGVRMEKGMQTERIIPDAETLELGIWSVPDDVLN
KVLILLKPRDLIRVAATCHHLRSLAASIMPCMKLKLFPHQEAAVEWMLRREQNTQVLAHP
LYKDFCTEDGFPFYINVTSGEVSTGNSPTINDFRGGMFCDEPGLGKTVTTLSLILKTHGT
LAYPPQGVDVSWCMHKPDKKYGYYELSPSCSSNRNSSSSVSKKLLREDVTTDDPCSSGLS
HDDDPVCSTRSSRKRGRLLSPDPTKVMFHATSEKSPSSSHSKVHPTPATHVLKFTKNSRQ
VRKNLMDAYSNGSVGNKRKRGTTSETNETWVQCDACRKWRRLSDATVLDSTTAWFCTMNT
DPTRQKCTAPEESWDFVKKITNLPGFYKKNSLPGNEENVSFFTNILKDNVAMINSETKKA
LIWLAKLSPSKLVEMELVGLTRPVLDTRATTGKGARPYYKIFQAFGLVRKIEKGVTRCRL
SAEWGPQKRSALKHVHWFRVILDEGHTLGSSLALTNKLQMAVALVASNRWILTGTPTPNT
PTSQVAHLHPMLKFLHDEVYGQNYQSWDSGIHRPFEAQMEEGRVRLVQLLQRTMISARKA
DLKNIPPCIKKITFLDFNEGHAKSYNELVVTIRRNILMADWNDPSHVESLLNPKQWKFRA
TTIKNVRLSCCVAGHIKVAEAGQDIQETMDDLVKLGLDPSSDEYQFIRIALLNGASCFRC
KVWCRLPIITPCQHILCLDCVALDSEKCTLPGCGNHYEMQTPAVRLENPKPKWPVPKDLI
ELQPSYKQDDWDPDWQSTSSSKVSYLVDKLISLRETYMNHGNNITNSAGHANALSCQPQA
MLDKVIIFSQFLEHIHVIEQQLTIAGITYAGMYSPMPLGSKVCFLIRDV
Download sequence
Identical sequences K3XE21
Si000138m|PACid:19676684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]