SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si000385m|PACid:19673497 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si000385m|PACid:19673497
Domain Number 1 Region: 102-247,693-754
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 6.15e-31
Family Tricorn protease domain 2 0.023
Further Details:      
 
Weak hits

Sequence:  Si000385m|PACid:19673497
Domain Number - Region: 585-748
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.000279
Family DPP6 N-terminal domain-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si000385m|PACid:19673497
Sequence length 778
Sequence
MAENWLEHEKHTSTAAPSSGLVSRRQIPSPRRSRQRNIFHLLTQREVSPRTKHQARRIWN
NSPICDPDLIELRFADADAKHGIFSWAESQSLHRWSAKYCPLLPPPRSTIAAAFSPDGKT
LVSTHGDHTVKIIDCHTGKCLKVLSGHRRTPWVVRYHPLYSDILASGSLDHEVRLWDANT
SDCIGSQDFHRPIASIAFHARGEILAVASGHKLYIWNYNKRDESSVPAIILKTRRSLRAV
HFHPHGAPYLLTAEVNNIESADSPLTLSTSSGYSNYPSALFVTNTNSRFCPHLESNVPSP
CLLLPAYLRDDGILHVLGNDSSSTSAQQRSSLVQVATLDTENQQPDQFATLMDVCPGEPT
ASNDMVDVVPVPASNGIEMHGADGQSNSRLQGSSSISNFERFGARDDLHVSSPSNTEPIP
STAGLSGSDARRAMPLNMLITGGLDVQMLLRNVESGQPNLFGNSRNWELPFLQGFLMAQN
HTGASSSIPITAGSSRGSNRRYASRSVPGVGSSLLGPQIDEAEVHAASLGVGSEITAPMF
TPGTELPCTVKLRIWRHNIKEPCRSLEPEACRLTISHAVLCSEMGAHFSPCGRFLVACVA
CLLPQTEGDRGSQLPVPYDSAGAGSSPTRHPLPSHRVIYELRVYSLEEATFGDILASRAI
RAAHCLTSIQFSPTSEHILLAYGRRHGSLLRSIVMEGDNGIPVYTILEVYRVSDMELVRV
LPSAEDEVNVACFHPSPGGGLVYGTKEGKLRILQHNGADTTTMGMGCFVEENMLEACL
Download sequence
Identical sequences K3XER8
Si000385m|PACid:19673497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]