SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si000758m|PACid:19675421 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si000758m|PACid:19675421
Domain Number 1 Region: 52-248,299-357,422-539
Classification Level Classification E-value
Superfamily RNI-like 1.53e-30
Family Cyclin A/CDK2-associated p19, Skp2 0.072
Further Details:      
 
Domain Number 2 Region: 21-54
Classification Level Classification E-value
Superfamily F-box domain 0.000000759
Family F-box domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si000758m|PACid:19675421
Sequence length 598
Sequence
MGGEVPEPRRLSRALSFGGSGGVPEEALHLVFGYVDDPRDREAASLVCRRWHRIDALSRK
HVTVGFCYAVEPARLLARFPRLESLALKGKPRASMYGLIPEDWGAYAAPWVAQLAATLEC
LKAVHLRRMTVTDEDIAVLVRARGHMLQVLKLDKCSDFSTDALRLVARSCRSLRTLFLEE
CKIGDKGSEWLHELAVNNSVLVTLNFYMTDLKVEPSDLELLAKNCKSLISLKMSDCDLSD
LIGFLQTSKALQEFAGGAFSEVGECTKYEKVQFPPRLCFLGSLTFMGKNEMPIIFPFSAT
LKKLDLQYTLLTTEDHCQLIAKCPNLLVLEVRNVIGDRGLEVVADTCKKLRRLRIERGED
DPGQEEQGGVSQLGLTAVAVGCRELEYIAAYVSDITNGALESIGTFCKNLYDFRLVLLDQ
QKEVTDLPLDNGVRALLRNCTKLRRFAFYLRPGGLSDVGLGYIGQFSGNIQYMLLGNVGE
SDNGLIQFAMGCTNLRKLELRSCCFSERALAVAVLQMPSLRYIWVEGYRASPTGQDLLLM
ARPFWNIEFAPLSPESVYRMMADGQQPCVGNQAQVLAYYSLAGRRPDCPQWLVTLHPA
Download sequence
Identical sequences K3XFT9
Si000758m|PACid:19675421 XP_004970611.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]