SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si001008m|PACid:19675818 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si001008m|PACid:19675818
Domain Number 1 Region: 66-110
Classification Level Classification E-value
Superfamily F-box domain 0.000000000523
Family F-box domain 0.0064
Further Details:      
 
Weak hits

Sequence:  Si001008m|PACid:19675818
Domain Number - Region: 194-306,353-397
Classification Level Classification E-value
Superfamily RNI-like 0.00208
Family Cyclin A/CDK2-associated p19, Skp2 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si001008m|PACid:19675818
Sequence length 524
Sequence
MEQQHPPPLITMEAMLEQMVSLGMGAEMVNPAMDLMYDFLGTFLPSPPVSATASLSADSS
PPGGGSEDHLSALPDQILRNVVSRLPAKDAARTAILSSRWRPLWRSAPLVLVDAQLLQSA
GAEDSPLRADFGSVTAAVSRVLEVHRGPFRFVHLTRSSMGAHRAELALWLDLLAVKGVEE
FVFVNRPWPLDVPLPATIFSLASVKRLYLGAWRFPNTSALPRGSAFPHLLDLGLGCVAME
DRDYDFILAKSPILETLVVYASQKHVNLRIISRSLRCVQLCMCIVHGVSLVDAPSLERLF
LWDARVPTPRAIDKKICTRVKFGHAPNLCFVGYLVPGVHVLEVGNTIIKVETRASPSTIV
PSVKVLALLVHFEVRNEAKMIPSFLKCFPNIQTLHIKSAKSDQPAGKLNQKFWQEHSGIE
CVQSHIREMVFHEYRGEHSELSFLKFILENAQVLRDMVIVFVRGSLSSGDNAAAKLMKDL
SSVKKASENCRLVIMESSISMGGTSWSCQVASNFDVADPFYYCY
Download sequence
Identical sequences K3XGI8
XP_004969069.1.39314 Si001008m|PACid:19675818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]