SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si001089m|PACid:19676716 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si001089m|PACid:19676716
Domain Number 1 Region: 130-231,301-365
Classification Level Classification E-value
Superfamily RNI-like 0.00000000034
Family 28-residue LRR 0.041
Further Details:      
 
Domain Number 2 Region: 7-54
Classification Level Classification E-value
Superfamily F-box domain 0.0000000131
Family F-box domain 0.0056
Further Details:      
 
Weak hits

Sequence:  Si001089m|PACid:19676716
Domain Number - Region: 26-115
Classification Level Classification E-value
Superfamily Citrate synthase 0.0401
Family Citrate synthase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si001089m|PACid:19676716
Sequence length 511
Sequence
MESHSRRQRRSNAAGATEEDRLSSLPDDLLHSILRDLPLKQAARTSALSRRWAPQWLRAL
AASPVIDLTDRDFARGQTPARAAATVGRCLRLHAEHGAPLDAFRVALVSPSPSGLVGDGS
ALGRDVVGCSLERLALDGFSLRAVRLPAAGLAGLRSLSLAHADVTDEAVRGVLTGCRALE
SLTLRSCPLLTSVTIGSERLRVLELLGCRALRDLRVAAPALESFAFHGRVYFSEADDYAV
PIELGDDTTMTMPALRDARMCHLGFGEYEDPNAQDFEYPFLYHVAHARVLTLCSIGLLLL
REQQTYDEMAYADLPNLEELQLLMATVDNEGLEHVSTFFMLTQLPVLQRLFVRVNLVHKL
CSVCTSSEKIHVFWNCLLPAEIVRYGLSHPQLPSDGGSSSAAALTDDDDADIILMFEVVL
EQLTFIKVASFRGTRHELRLLRFFLKRAPVLEQMVLVTVEGEGAPGDEHLKDIYERVSVL
QKASREARVSVCRPNEDDSPNHAHTMFYREE
Download sequence
Identical sequences K3XGR8
Si001089m|PACid:19676716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]