SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si001118m|PACid:19678432 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si001118m|PACid:19678432
Domain Number 1 Region: 153-270,321-348,405-447
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000487
Family Cyclin A/CDK2-associated p19, Skp2 0.03
Further Details:      
 
Domain Number 2 Region: 3-39
Classification Level Classification E-value
Superfamily F-box domain 0.00000144
Family F-box domain 0.0065
Further Details:      
 
Weak hits

Sequence:  Si001118m|PACid:19678432
Domain Number - Region: 19-91
Classification Level Classification E-value
Superfamily Citrate synthase 0.012
Family Citrate synthase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si001118m|PACid:19678432
Sequence length 506
Sequence
MEDRLSSLPDDLLHSILRGVPLKHAARTSALSRRWVAHWIRALAASPVLDFTDSNFAYGQ
PPARAAATVDRCLRLHAEHGTPLHVFRVALVSPSVPGDGAFGRDVVGWIAAAVTRGAREV
EVDLTPSQEDADPGSAANSLERLALGRLSLRAVPLPAAGLAGLRSLSLSHADVTDEALRG
VLANCGALESLSLRCCSLLTTVSVASERLRVLELLGCRSVRELRVAAPALESFALYGNVI
LSVTDWFDSVAVDFGAAPALRDVYLSQMDCCGSLDRNIDYYYPFVYHVPQARILTLCSVG
LVVPIFSLDSDDDNHFDHFPYAHLNGDDSAYIDMPNLQELQLLMGSLEEEMSTQDPRFPE
RVYYFFNYTSLPVLERLFIRLASNPANGSSSEPDEDDDDAEIRFGPHEIVLGQLTFIKVV
NFRGTWRERRLVAYLLKRAPILEQLVLVTVRGEGAPGDEQPENIKEWVSELQKASCEARI
TVCRPSEDDSPNHAHTRFFHEEYCCT
Download sequence
Identical sequences K3XGU7
Si001118m|PACid:19678432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]