SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si001196m|PACid:19674724 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si001196m|PACid:19674724
Domain Number 1 Region: 32-74
Classification Level Classification E-value
Superfamily F-box domain 0.000000183
Family F-box domain 0.0098
Further Details:      
 
Weak hits

Sequence:  Si001196m|PACid:19674724
Domain Number - Region: 193-258
Classification Level Classification E-value
Superfamily RNI-like 0.0366
Family 28-residue LRR 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si001196m|PACid:19674724
Sequence length 491
Sequence
MEEIFSCIPTQPLPSPTAAAACSDGDGGEDGEDRISRLADALLSDIVSRLPAKDAARTAA
LSPRWRRVWAATPLVLDDAHLLPDEPDGPLGFGTDWRAIADAVSRILDAHPGPFRSVRLT
HVCNYAAIRGGGDLARDWLRVLAAKGVDDLVLVCRPWPIGADLPAKVLRVASLRRLYLGL
WDDFAGSTKALRRGNVVFPRLLELGLCRTDIETADIDRLLQCSPLLEKLALVACYNSPPK
VRVRSRSLRCVLFWMSGAEEVDVLVAPRLERLILWSECPGARFDDNFHTRLNIGYVQELK
VLGYLDTRLHALEISNTVVEAGTKPSPRTIVPSVKILALKVRFGVRKEAKMLPSFLRCFP
NVVTLHIMSDKADEPTGKLNFKFWQETGPISCLQSQIKRVVFRNFRGNRSELAFLRFIWE
RAQLLHKMVIVLADGDDPASMEQMIAKLKPLAASAKRASKDRKLTILVRNGDCAWSFRRA
SDLSVSDPFDC
Download sequence
Identical sequences K3XH25
Si001196m|PACid:19674724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]