SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si001199m|PACid:19674781 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si001199m|PACid:19674781
Domain Number 1 Region: 38-82
Classification Level Classification E-value
Superfamily F-box domain 0.000000000144
Family F-box domain 0.007
Further Details:      
 
Domain Number 2 Region: 167-372
Classification Level Classification E-value
Superfamily RNI-like 0.0000687
Family 28-residue LRR 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si001199m|PACid:19674781
Sequence length 490
Sequence
MDLEELMRIVLTCLPARPFPTAAGSRPSPSARRGGGGGEDRISRLPDAVLSNIVSRLPAK
DAARTAAFSRRWRRVWASAPLVFDDSDILALPARGGDPEPEEWYAVTDAVSRVFCAHRGP
IRCVRLTCCIMALAARMGTLGYWLHRLADAGAEDLVLVNRPFPSGLHLPADILRIASLRT
LYLAFWRFPDTRGLPRGPAVFPRLQEIGLCHVGIDDRDIDHLLACSPVLQKLAFVATFYE
GPVRIRSRSLQCLVSWMALTNELAVVVAPRLQRLILWQAYPRVSDFPFRTKVRIGYTTEL
KVLGYLEPGIHQLEIGGTIIESGTKMTQSTMVPSVKILALKVQFEIRKEAKMLPAFLRCF
PNLETLHVLSHEADEPTGKLNLKFWQEVGPIDCLETHITKVVFDKFRGERCELAFLKFIL
ERAQSLLKLVVVLSNGDQASVDEMLTKLKSLTTAKRASECPTLLAVARDGDSAWCFQRAS
DLSVSDPFDW
Download sequence
Identical sequences K3XH28
Si001199m|PACid:19674781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]