SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si001261m|PACid:19673805 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si001261m|PACid:19673805
Domain Number 1 Region: 108-297,377-480
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 1.7e-98
Family Transcriptional factor tubby, C-terminal domain 0.00000987
Further Details:      
 
Domain Number 2 Region: 45-103
Classification Level Classification E-value
Superfamily F-box domain 0.00000497
Family F-box domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si001261m|PACid:19673805
Sequence length 480
Sequence
MSFRSIVRDVRDGFGSLSRRSFEVTLASIYGLTGHHKGKTQSSSHELDDSPSIIRESRWA
SLPPELIRDIIRRLEADESTWPARKHVVCFAAVCRTWREMCKEIVLSPEFCGKLTFPVSL
KQPGPREGNTMIQCFIKRNKSKSTYQLYLCLSNVVTSESGKFLLSARRHRKTTCTEYTIS
MDSGNTSRSSRTYIGKIRSNFLGTKFLIYDTQPPYNGAVVPPVGRTSRRFNSTKVSPKLP
SVSYNIAQVSYELNVLGTRGPRRMRCSMHSIPASSVEPGGIVPGQPEQIVPRALEDSFRS
TASFSQSFRSTTSLSKSIMDSSMDFNSARFSDIAGSGSSARFSGIGSSARISGIGSSARI
SGIASGRLDHDEDSEVKERPLVLRNKPPRWHEQLQCWCLNFRGRVTIASVKNFQLIAATT
PPPAGAPTPSQPAPSDPDKVILQFGKVARDMFTMDYRYPLSAFQAFAICLSSFDTKLACE
Download sequence
Identical sequences K3XH90
XP_004970704.1.39314 Si001261m|PACid:19673805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]