SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si001382m|PACid:19673453 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si001382m|PACid:19673453
Domain Number 1 Region: 5-40
Classification Level Classification E-value
Superfamily F-box domain 0.00000301
Family F-box domain 0.0052
Further Details:      
 
Domain Number 2 Region: 155-214,268-321
Classification Level Classification E-value
Superfamily RNI-like 0.0000746
Family Cyclin A/CDK2-associated p19, Skp2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si001382m|PACid:19673453
Sequence length 457
Sequence
MAAEVSDLPDDILVSIVSFLPIGQAARCSALASRWPRIFPRTLIKFGASLSTHRHGAIDI
VNSILAAHPTAAVRYFSIASICFRGDEDPNAGGWLQELALRGVQEINLSFREIRRMIPAS
LFAIRMHLPDAPQGHNCTFPDARAAAAAAGGVPLLPHLAQIDLYDVVLPSDSLHALLSHC
TALEHLKMCKMHECGRVHVRSPSLRFLCSDGFFDELFIDDAPKLEWVLGYDMYFYSFRTA
RLTIVHAPKLGFLGYLGVGSPAIQIGATIFTEDQIIVKTLMPNLKTLAVKLKNMSRAGEV
KRFMQLLELFPNLETLYIQGYRCLVQPEDWSVNQDAAASWDDLRLAPCVHNHLERVVFQD
YSGHGWQRQMAKFLHGNSRFLKTLEFHCMDHVETRPFGIRPPSPDLVRKQREVLCLDSRA
SRDACFLFFKHMLATHHHVSCHQESYKRKYYDNLYEI
Download sequence
Identical sequences K3XHL0
Si001382m|PACid:19673453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]