SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si001542m|PACid:19678164 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si001542m|PACid:19678164
Domain Number 1 Region: 12-78
Classification Level Classification E-value
Superfamily F-box domain 0.000000000301
Family F-box domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si001542m|PACid:19678164
Sequence length 428
Sequence
MTSVTDPSQPPPARTPSTIHSLGEDLLLDIFLRLPSLAALIRAALTCRAWRRAVASSPAF
RRHFRDIHRAPLLGLFFETPSVGQAPAVPAFPSFVPARRSDRDLAAAVRGGDFFLTSLQE
RPGGPHGWDILDCRGGYILLRNDEEEIMAVLNPLARRSERFFDLAHEDTLQGHRGYPVVC
YNACLLCSDEDPLSFRVVLLAHDESRVRATFFSSDTNEWSILPWVNVPASSSRKKFWLLD
SSMQSKGFLYWVYKNRKYMITLNTVTMEFSVDELPQLLKNEHCSFVVGETSSGARCIVYA
IDFCVGLLLRRTENGIIERWDLQWAARLDTQLDQVLGELISVYDELQVVAVRDGFAYLAT
SEKSDDTQTPSWFLSFCLQTMELEKLFQRTYDAGVYPYVMTWPPSLVGNYGSFALEDATQ
NAITGHQM
Download sequence
Identical sequences K3XI20
XP_004969092.1.39314 Si001542m|PACid:19678164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]