SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si001556m|PACid:19674776 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si001556m|PACid:19674776
Domain Number 1 Region: 20-82
Classification Level Classification E-value
Superfamily F-box domain 0.000000000127
Family F-box domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si001556m|PACid:19674776
Sequence length 425
Sequence
MARDRSPTNSPPAKRRKESSTTTVAALGEDILLEIFLRLPCLATLVRAALTCRGWRRAVA
SYPAFHRRFRQLHPAPLLGLLFNPPGPVQDPELPAFPSFVPTRGTDRDQAAAVRGGDFFL
TSLQERSGVHNGWDIHDCRGGYVLLANGDQETMAVVNPLVRRSERFLDFGHKDTLEGHRA
CGIVHRACLLCSDEDPTSFRVIIIAHDKSRVRATVFSSETGEWSVRRWVHIPARPRRGRG
ERWILNSNMQANGFLYWVSKNRKYMVTLDTATVDFSVNELPIFLQNRHCTFVVGEMKNGE
ACIVYAINFTVGVLFRRTESDGVDRWVLDRAELLETQLGRVLGEVMENYNEVEVVAVRDG
FAYLATTESLNDSGTPSWFLSLCLETMILEKLFQRTYDSSVHPYVMPWPPSLVGNYGRFA
PEDGT
Download sequence
Identical sequences K3XI34
XP_004969091.1.39314 Si001556m|PACid:19674776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]