SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si001571m|PACid:19677966 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si001571m|PACid:19677966
Domain Number 1 Region: 12-71
Classification Level Classification E-value
Superfamily F-box domain 0.000000183
Family F-box domain 0.0059
Further Details:      
 
Domain Number 2 Region: 54-286
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.0000392
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si001571m|PACid:19677966
Sequence length 424
Sequence
MADHPLTGEHHPSPASSAATALGTLLLLPSELLHEILLRLAVPELLRVRSVARPLSSLIS
SPDFRRLYHLSSASSGPGPAAAWLLLFKKLPPRDAAIRGFHGPSGRWFRIPVSAILAPAV
PPGEDLYFLAASGSSFLFAANGRRELVVVDLTARAARRLPPSPLGPRGTSSWRRFGLKLV
ADPPGSNRFRFLFAELVNNTPFLFEYRSETDTWQQSEAVLAEGAAPAAPDGTFLCAAHVG
PDCVMVYSGPGADGDRPVFFRPRFPNAAAAAGHGDRLHVYGDGSAAVVRSVAVDDPMSRT
RVKVVTGVELYGFGSVGGDWELVASVPGELVEGFRKPYAVMTGLLAEREGVVRLVLISNC
RGAWDLVWLSYDRSRREWRWVPVPDWGGSKGLNMAGMAVSSTFSRLWPLAAPPPPPSSSS
SSHQ
Download sequence
Identical sequences K3XI49
Si001571m|PACid:19677966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]