SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si001607m|PACid:19676835 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si001607m|PACid:19676835
Domain Number 1 Region: 87-109,156-278
Classification Level Classification E-value
Superfamily Kelch motif 0.0000068
Family Kelch motif 0.017
Further Details:      
 
Weak hits

Sequence:  Si001607m|PACid:19676835
Domain Number - Region: 35-77
Classification Level Classification E-value
Superfamily F-box domain 0.000144
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si001607m|PACid:19676835
Sequence length 419
Sequence
MGAGVRAHDLKHRRHQDDGCEPDAASLAAAYLYGDVLESVVERVPAPDLAVAARVSREWL
RAVRAALRRRPRRLPWLVAHVQGRGGSRRAAAYDPCSGAWLAVPAPPRHATPSHVRLVRG
ARGDRVCALSLSGLAVAGDPLGAAACVAVAAPRVWRVDPVFAAVGDRVVALGGACRLALA
EGEDEAAVEVHEGGGWTACDPMPDALRDSASATWLSAAATDQRVYLVERATGWASWFDPA
KRRWGPTRRLGPDPAVTTWGVAPGRAGADERLVLFGANRADKEAECTVVVQAWEVDGETL
EPIPSASSDAMPPELSERLFPRDDTDDEDDLDDIDPERLSIGVCGNAAGGYVYNAAEPSH
GAVLYELREEEGKATAVARWEWVPCAPAVQAEPLGRAILACSPVGLDELAAAVGARAPR
Download sequence
Identical sequences K3XI85
Si001607m|PACid:19676835 XP_004969679.1.39314 XP_004969680.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]