SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si001612m|PACid:19675063 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si001612m|PACid:19675063
Domain Number 1 Region: 104-379
Classification Level Classification E-value
Superfamily RNI-like 5.1e-19
Family 28-residue LRR 0.036
Further Details:      
 
Domain Number 2 Region: 2-56
Classification Level Classification E-value
Superfamily F-box domain 0.0000000222
Family F-box domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si001612m|PACid:19675063
Sequence length 417
Sequence
MEHLPVEVIGNILSHLGVARDVMVASAVCRKWRDACRRHLRLLSFNSDDFPRDMTTRQLE
IVITQTIFQTIGLQCLSIHIDNTHEFSAAPVIAWLMYTRETLRSLSYNVRTTPHVNILEK
CGRQKLEVLDLDHNTITGVEPSYQRFTCLKSLSLRHVSISALDLSLLVAACPKIEVLALD
VLEVVTSDPQSTMELTSHTLRSLFAKSVGVDKIILDADNLEVLHLNALNLDLFELIGKGT
LKHLKIDDVSVTHLDIGDSTEHLEVVDVSNFTIVWPKFYNMISRASSLRMLRFWGVVFDD
EDEIVDSETIAVSFPLLRHLSLSYELRDGLLHYSLQGSSPLENVSVLELGWTVISEHFGP
WVFGMIERCPNLKKLVIHGVLSEAKTREERQMLASFTSFIVCLMRKYVHVDVQFEYE
Download sequence
Identical sequences K3XI90
Si001612m|PACid:19675063 XP_012701178.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]