SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si001654m|PACid:19677561 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si001654m|PACid:19677561
Domain Number 1 Region: 79-137
Classification Level Classification E-value
Superfamily F-box domain 0.000000000278
Family F-box domain 0.012
Further Details:      
 
Weak hits

Sequence:  Si001654m|PACid:19677561
Domain Number - Region: 262-337
Classification Level Classification E-value
Superfamily Phage tail proteins 0.0104
Family Baseplate protein-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si001654m|PACid:19677561
Sequence length 409
Sequence
MLPLLLISTVPAFTLLLVAPATKPCCKLARELGLLALLLATELLNHATAAGRRFLGRDRG
ARMMLSPPRPKPAALAAPPAAAGLPLLDLPELALDRVLEELSPASLAAMACVCAALRGRC
SADALWERHLRAKWGRVLGGTARKEWEAELGARATRASAPRPARRRSWADSLACAWPFSW
IAGRWLKGDATPAPAAVAAEPAPATAAPPTDTVAAWYRALECGDFWFPAQVYNREDGHVG
FVLSCYDAHLRYDRRTDTFTARYPPHGRKPAKEEDGVQWSRIRAPPVSTPAHDLHGSGCL
GALRPGDHFEIQWRKNKDFPYGWWYGVVGHQASCNANEHLWCRCHEDDMIVLEFQHYAPG
SRWRQTTVSRKDHRETGDETDGFYGGIRKLQTKDEIATWRRFWPVDVLN
Download sequence
Identical sequences K3XID2
XP_004970298.1.39314 Si001654m|PACid:19677561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]