SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si001691m|PACid:19674845 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si001691m|PACid:19674845
Domain Number 1 Region: 86-143
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000157
Family F-box domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si001691m|PACid:19674845
Sequence length 405
Sequence
MLALLTAFVVACLLFLSKPCARDMRLCLASLCQQLALSLLGFLAGLRLIGGVAAASAASE
TMPLMPSFKRKRAVATVENVEAAGGGGGEPSVLDLPELAIDCILERLPPAELRNMAAVCR
SMRERCRGDHLWERHMSEKWGRVLGHAARDEWRAHLASASESGGAGSATGGGGKRRRWLA
ALSCVCPVVSWMRPKADGAKSSGPVLDDSIMSWYLSMESGKFWFPAQVYNREHGHVGFMM
SCYDAELSYDFHTDTFRARYPPHGRRTVVLEDGVQWDRVRAPPVDTLAHDLHASDCLHEL
RPGDHIEIQWRRNKEFPYGWWYGVVGHLESCDGNEHFCRCHLSDTVLLEFNQYTPGSRWR
QALVNRKDHREEGNEGDGFYGGIRKLRSKDDISKWRQLWPTDILE
Download sequence
Identical sequences K3XIG9
XP_004967668.1.39314 Si001691m|PACid:19674845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]