SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si001759m|PACid:19673663 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si001759m|PACid:19673663
Domain Number 1 Region: 119-185
Classification Level Classification E-value
Superfamily F-box domain 0.000000000981
Family F-box domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si001759m|PACid:19673663
Sequence length 394
Sequence
MGKAISLLRPPQLPREDEAGMMELRKRPRTPRVDPDFVSSPPPPPPRKRARKQAAPTKPK
EAAGPAKRQPPTKRPRRPAVGIGCPVAGLHRVTCSRQPPLRTSTRVLFRPRRPFNWYEPD
MWTEVAKHLCGFDLLRLSFTCRWFRRLLADDSIWRYAFFRDLDLSDANPRIHRPFYRSWR
RLYFAAFDGTHAYSLCQSGEHRSSWRIGSFLLDSPQMLLMGKLPVPRWLPPDPEDLQLGV
AMMGACKLHNARPGIWITDMHVMRCPKCNLNSCRGNMQILDARHSELFLEEAYWDQTWEY
EELGEHFQDEEVADAFCAIINAKHLASPSTAVVLSKSWAGKRDDLLTKQCASATGAAIHT
NLQSNAGLVSQFEAMRDTARDGQIVSVRISQVLL
Download sequence
Identical sequences K3XIN6
XP_004967500.1.39314 Si001759m|PACid:19673663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]