SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si001786m|PACid:19676975 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si001786m|PACid:19676975
Domain Number 1 Region: 118-233
Classification Level Classification E-value
Superfamily HCP-like 0.00000000000288
Family HCP-like 0.0068
Further Details:      
 
Domain Number 2 Region: 332-379
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.00000000349
Family MYND zinc finger 0.014
Further Details:      
 
Domain Number 3 Region: 48-99
Classification Level Classification E-value
Superfamily F-box domain 0.000000131
Family F-box domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si001786m|PACid:19676975
Sequence length 391
Sequence
MRTRSGSLYSNNGGEVAVGQKRKRSAPMLGQSAVAGECAGQGRRKRLAGGPDYLDELPDD
LVLSILSKLAASASAPSDLLSVHLTCKRLNELGGHDMVFAKASPASLAVKAAAWSEPAQR
FLKRCADAGNLEACYILGMIRFYCLGSRSGGAALLARAAVGGHAAALYSLAVIQFNGSGG
AKSDRDLRAGAALCARASALGHVDALRELGHCLQDGYGVRRDPAEGRRLLVAANARELTL
ALAAAAASRHPFAAAVPLGAAAAAAAGAGGCPLLSDFGWSLPEAEPHAANQFMVDWWASR
GAQAAAGKKLGPGAGTGDSDSDGGELRLCSHVRCGRRETRRHEFRRCSVCGAANYCSRAC
QALDWKRAHKAQCVPMDRWLLAAANAGEAPQ
Download sequence
Identical sequences K3XIR3
Si001786m|PACid:19676975 XP_004971088.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]