SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si001860m|PACid:19675155 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si001860m|PACid:19675155
Domain Number 1 Region: 82-284
Classification Level Classification E-value
Superfamily RNI-like 4.12e-41
Family Cyclin A/CDK2-associated p19, Skp2 0.0021
Further Details:      
 
Domain Number 2 Region: 31-75
Classification Level Classification E-value
Superfamily F-box domain 0.00000955
Family F-box domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si001860m|PACid:19675155
Sequence length 379
Sequence
MDSTKPLGGELNNSLDTLMVSSGVESKQAQNAGTETSLTGWKDLPMELLLRIMSLVGDDS
MVIVASGVCTEWRDALGWGIANLSLSWCQDHMNDLVISLAHKFTKLQVLSLRQIKPQLED
SGVEAVANYCHDLRELDLSRSFRLSDRSLYALAHGCPHLTRLNISGCSNFSDAALVFLSS
QCKDLKCLNLCGCVRAASDRALQAIACNCGQLQSLNLGWCDGITDKGVTSLASGCPELRA
LDLCGCVLITDESVVALANGCPHLRSLGLYYCQNITDRAMYSLAANSRVRSQGRGWDAAK
RGSGKDRDRDGLASLNISQCTALTPPAVQAVCDSFPALHTCPERHSLNISGCLSLTSVHC
ACALHPHRAGRAILSNHAY
Download sequence
Identical sequences K3XIY7
XP_004970783.1.39314 Si001860m|PACid:19675155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]