SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si001914m|PACid:19675295 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si001914m|PACid:19675295
Domain Number 1 Region: 102-370
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 4.97e-81
Family Transcriptional factor tubby, C-terminal domain 0.0000107
Further Details:      
 
Domain Number 2 Region: 40-94
Classification Level Classification E-value
Superfamily F-box domain 0.00000144
Family F-box domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si001914m|PACid:19675295
Sequence length 370
Sequence
MPPWRRASASPGPSAAAAASSSEPARPLAGGNARVSPEVPAEHEGGVEDGRWSALVPELL
ADILRRVDAGAERWPGRRDVVACACVCRRWREAAVAMVRPPLQCGGITFLASLKQPGPRD
APMQCFIKRNKKKSTFHLYLSLTQALTGQGKFLLAARRNRCGFRMEYIISTQGDLSHGSH
VGKLKSNFTRTKFTVYDWQPQYEGAKVSSSRCRRWLASKQINPLASSGIVDIGEVSYEYN
LLKSRGPRRIHCSIQCPADEGTAIDPEEANQPSSPSSLVLYNKLPRWHEHLQCWCLNFHG
RVMVASVKNFQLIAPAGTGEPWGVQDDETVILQFGKVEDDVFTMDYRQPLSAFQAFAICL
TSFGSKLACE
Download sequence
Identical sequences K3XJ41
Si001914m|PACid:19675295 XP_004970029.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]