SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si002043m|PACid:19674224 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si002043m|PACid:19674224
Domain Number 1 Region: 5-59
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000366
Family F-box domain 0.0096
Further Details:      
 
Domain Number 2 Region: 103-305
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.000000824
Family Tricorn protease domain 2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si002043m|PACid:19674224
Sequence length 349
Sequence
MDAELGEDVVTEILARLPARSLARFQCVSTSWRRIISSDYLRRMLPLITSGVLYHDGPRG
GGDDGARRAYTYACAPDGGGVAEAGDMAFFPRHNASTIIDGCNGLLLYYASRPAAFHVVN
PTTRRWAALPAPRARTLLSVLAFDPCASPHYKVVCFTGWLPRGATIEVFDSERGAWRDHE
VDFGIDTDAMSATMHYSGGALHVLAYSGHVVRLDLGTMACAVTALPAPVSCRARAGHCRG
RLRFASSDGTRLRIWELEDADAGDWALKHEIGVSDVVPGGSSQAITFLFMAFHPEREVVY
LWSPWKLLAFDLVEKRVEEEWAFGSDKEGAHLIQIWLFPFSRHLANALA
Download sequence
Identical sequences K3XJH0
XP_004970760.1.39314 Si002043m|PACid:19674224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]