SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si002057m|PACid:19676443 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si002057m|PACid:19676443
Domain Number 1 Region: 113-318
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.000000000000209
Family Galactose oxidase, central domain 0.041
Further Details:      
 
Domain Number 2 Region: 12-60
Classification Level Classification E-value
Superfamily F-box domain 0.000000615
Family F-box domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si002057m|PACid:19676443
Sequence length 347
Sequence
MASSTTTAVDCPWDALPSHLQERILSLIPVTELLPVAAASRALRRLLRSPAFHALLSPHR
LDAFFLITPRLAVHPLSRRVLRTPQLAALCPPSYPLVSSASPSRLITYATLHSLPPIPDG
SYLLSVVVQPAPSSSCILVAVTTGAAVRSYTLDADDPSRQWASRGDLPVSISLLGNAAVA
GDRSQLFVLGRGPDALLVFNLATGTWEVLLVVMPQGLTTAHLFVYDGRLFMVGGVERLGE
VERVVVWRLEDGKEVMLWREVGVMPVEVFDELVAGRHGSFWHFQAADRLGIVCLYNVVDG
RLVMFDAADGLWTVLPRVSGMDAEESGRWFGHVLEPGVELLLGQHHR
Download sequence
Identical sequences K3XJI4
XP_004968844.1.39314 XP_004968846.1.39314 Si002054m|PACid:19676442 Si002057m|PACid:19676443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]