SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si002062m|PACid:19677280 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si002062m|PACid:19677280
Domain Number 1 Region: 14-62
Classification Level Classification E-value
Superfamily F-box domain 0.000068
Family F-box domain 0.0062
Further Details:      
 
Weak hits

Sequence:  Si002062m|PACid:19677280
Domain Number - Region: 108-327
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.000824
Family YVTN repeat 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si002062m|PACid:19677280
Sequence length 347
Sequence
MSAKVPRRLEITSSGMADWATLQTDIVGLIVKKLAVPDYIRFRAVCTSWNHVCKDVSYCP
RVDPWLMLPPNPTPLGAQFFCIPERKNQNIRLPSTASFFESVWAPVGSLNGWLIYFSQTY
GTMQLVNPISGRQIQLPPIGRRIFSKAKLLEMNERNFIVAVLYGDQKGYKITRKGSNNWS
SVESTHILDDIIKHRGRLYTCDMYGTVEVWAEPPRAWPDEEMTHQWRFRCLVETPAGDLI
RVKRQSQNKFAVWILDKGSFSWVETDNIGDFALFVSHYNSFCFLAKDHPNLKANCIYFID
IHNNLCAFNLEHGTKELVETLAIGLDRNDYYRRPQRDQLLWFIPSLK
Download sequence
Identical sequences K3XJI5
XP_004968451.1.39314 XP_004968452.1.39314 Si002058m|PACid:19677281 Si002062m|PACid:19677280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]