SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si002176m|PACid:19677282 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si002176m|PACid:19677282
Domain Number - Region: 4-56
Classification Level Classification E-value
Superfamily F-box domain 0.000144
Family F-box domain 0.0062
Further Details:      
 
Domain Number - Region: 82-287
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.000183
Family Tricorn protease N-terminal domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si002176m|PACid:19677282
Sequence length 332
Sequence
MADWATLQTDIVGLIVKKLAVPDYIRFRAVCTSWNHVCKDVSYCPRVDPWLMLPPNPTPL
GAQFFCIPERKNQNIRLPSTASFFESVWAPVGSLNGWLIYFSQTYGTMQLVNPISGRQIQ
LPPIGRRIFSKAKLLEMNERNFIVAVLYGDQKGYKITRKGSNNWSSVESTHILDDIIKHR
GRLYTCDMYGTVEVWAEPPRAWPDEEMTHQWRFRCLVETPAGDLIRVKRQSQNKFAVWIL
DKGSFSWVETDNIGDFALFVSHYNSFCFLAKDHPNLKANCIYFIDIHNNLCAFNLEHGTK
ELVETLAIGLDRNDYYRRPQRDQLLWFIPSLK
Download sequence
Identical sequences K3XJV3
Si002176m|PACid:19677282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]