SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si002408m|PACid:19677180 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si002408m|PACid:19677180
Domain Number 1 Region: 52-104
Classification Level Classification E-value
Superfamily F-box domain 0.0000048
Family F-box domain 0.0073
Further Details:      
 
Weak hits

Sequence:  Si002408m|PACid:19677180
Domain Number - Region: 95-144
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.00314
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.0085
Further Details:      
 
Domain Number - Region: 200-225
Classification Level Classification E-value
Superfamily RNA polymerase subunits 0.0471
Family RBP12 subunit of RNA polymerase II 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si002408m|PACid:19677180
Sequence length 297
Sequence
MSEGARNTRRFFGASSSGAGESGTGSAGYRDGGGGIVVSRSSDVNTGIQDENVLALVFRS
INFDPKAVCTVACVSRRLRAVAERVLWRELCISRAPRMVASLTGVPVGGPPPPGRIVGGW
PALAKLLLFCCGAASASVPGHSTGVSRFSKTSGRSFLARRCRGDLLYVSDPCEHAAPGAD
DDVGAYRGVFRGFMRSRTRACLVGRQAALEARVRCPYCGARVWSMVAAGMVPRIAWRRLG
AYEGRLEYYVCVSGHLHGNCWLARLTSSDGEHGGGDSEDDDDDASTESGSDDGRAAS
Download sequence
Identical sequences K3XKI5
XP_004970282.1.39314 Si002408m|PACid:19677180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]