SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si002471m|PACid:19676992 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si002471m|PACid:19676992
Domain Number 1 Region: 154-277
Classification Level Classification E-value
Superfamily NTF2-like 3.29e-26
Family SAV4671-like 0.01
Further Details:      
 
Domain Number 2 Region: 83-166
Classification Level Classification E-value
Superfamily F-box domain 8.37e-16
Family F-box domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si002471m|PACid:19676992
Sequence length 286
Sequence
MDGVRALIAAGATAVCCLVGAFWAFRSSSPSSSSKTQQSPSLNCCGCASCGCRAARSANG
EMAVGGENKKKAQEPAPPEGGGGGASMMEQLVPEITTHALSYLDYTSLCRLSMTNSAMRR
AANDDGAWKALYHKDFTVEQGTINPPNGWKAYYAATKAIMNLNAEFYNIIREGSLPAMSR
FWLNADYVKCIHANGEFFTGYNAVMGGWSLLFNWGQDGGQGVGFQIRDVRVRVLGEVAWV
NLKANIDLDPVLCHVTNVFEFRNGRWYMVHHHSSLMAEPAPHNMFG
Download sequence
Identical sequences K3XKP8
Si002471m|PACid:19676992 XP_004968943.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]