SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si002706m|PACid:19678920 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si002706m|PACid:19678920
Domain Number 1 Region: 4-62
Classification Level Classification E-value
Superfamily F-box domain 0.0000000111
Family F-box domain 0.01
Further Details:      
 
Weak hits

Sequence:  Si002706m|PACid:19678920
Domain Number - Region: 75-144
Classification Level Classification E-value
Superfamily Tropomyosin 0.00501
Family Tropomyosin 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si002706m|PACid:19678920
Sequence length 244
Sequence
MSASDLPDELWARVLELGAASSALGFRDLCCLAIASRRLGRLSLHPALWSALFSRDFPSQ
SQPSSSSSSSTSQQQQQQQQLHPKSLYKTKFERHKVRIAEARRRAVFEAEARVLACRRRL
AELEESMRAEGEKMKAAAQELDNLERVRRASVALNVWQPQVVHGRQKQLVQQCTVPVDSR
LSDLNMELKVCKQQIATYKNSYSKEKHKLNEYEEALKRAKYHPLQDSHTSGIIKEPRAKR
KKLK
Download sequence
Identical sequences K3XLD3
XP_004970341.1.39314 XP_004970342.1.39314 Si002706m|PACid:19678920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]