SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si002911m|PACid:19678921 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si002911m|PACid:19678921
Domain Number 1 Region: 4-62
Classification Level Classification E-value
Superfamily F-box domain 0.000000018
Family F-box domain 0.01
Further Details:      
 
Weak hits

Sequence:  Si002911m|PACid:19678921
Domain Number - Region: 75-144
Classification Level Classification E-value
Superfamily Tropomyosin 0.00392
Family Tropomyosin 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si002911m|PACid:19678921
Sequence length 211
Sequence
MSASDLPDELWARVLELGAASSALGFRDLCCLAIASRRLGRLSLHPALWSALFSRDFPSQ
SQPSSSSSSSTSQQQQQQQQLHPKSLYKTKFERHKVRIAEARRRAVFEAEARVLACRRRL
AELEESMRAEGEKMKAAAQELDNLERVRRASVALNVWQPQVVHGRQKQLVQQCTVPVDSR
LSDLNMELKVCKQQIATYKNSYVCDHLFHFI
Download sequence
Identical sequences K3XLY8
Si002911m|PACid:19678921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]