SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si003827m|PACid:19675517 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si003827m|PACid:19675517
Domain Number 1 Region: 37-73
Classification Level Classification E-value
Superfamily F-box domain 0.000000113
Family F-box domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si003827m|PACid:19675517
Sequence length 427
Sequence
MPPVRRPSAHPAASPYTDGWLSRRYRIAFASDVGGGAPPTNLPDDILFGIFSRVSGAADV
SRCAATCRHWGRVRVVAARAAAISRALPPPARFLPRLALGFFHQQQNGVSHSVRVGAQLR
FIPMASTSLLLGPSGGGARLIHEGGALFEHARPIASRNGRLVLELRREARADGLALCVWN
PMTGDAAVLPTLSGKDSPGDYACAILTGDDLDGVPPRSTDFFRLLLVYNRRAAPQHCGPT
RRTPAAGGQKATIPARPSWSAAWPTFGVRLDDGTMAAAATMDVCSVPYALKNCKLDKHVL
GVSPDGRLRFVATGFVARRLLVISSLISQLQGSVHYDSTAGDISIAVPQIEVTRTNWNTI
KLRWFGEKTGTLIFTVGETVSTCAIFALNLASRSLEKLPHGVSYHACRNLCGYEMDRAAL
LAWLAPQ
Download sequence
Identical sequences K3XPK0
Si003827m|PACid:19675517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]