SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si003828m|PACid:19676252 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si003828m|PACid:19676252
Domain Number 1 Region: 58-114
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000275
Family F-box domain 0.0071
Further Details:      
 
Domain Number 2 Region: 160-248,306-447
Classification Level Classification E-value
Superfamily RNI-like 0.0000000116
Family 28-residue LRR 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si003828m|PACid:19676252
Sequence length 505
Sequence
THGSSTQFAQPVSLSACVTPARGPATMSIPSGLKRFLSCFPARSSSVTGATVSDPDGEDI
ISGLPDDVLSSIVSLLPINDAARTAALSSRWRDLWASNPLVLDDIDLLLNNPSHVGAVTS
TVSHAITAHPGPFRSVKLTCYFSDADESTLHHWIRVLAAKGVTELVLNNIPWAGLDLLPC
AILECRSLQRLRISEWRFPDTSGAAAVLRQGVAALPRLRELVLRRSIIQEQDLDRVLASS
PKLKNLVFVLSRGAPAQVRLSSRSLWCVVFWQSVVEELAVVAAPLLERIILRTSSSPCGI
NGKDGSCMRIKISSASVLQALGYLNPNYHELQIGDTVVKVVPDAVVPSVKILALSIQFGV
PNKARMMSCFLRCFPNIETMHIQSIPDRGATSKNGNSDFWNEIDSVKCIKESINKVVIHG
FRWENCEIEFLKSILEGGNVLQKIYILQDKNVTVSEGAINGTLSLLASLKKKGVIALMIL
AGQDGIWSYEMASDVSRNDPFDCQS
Download sequence
Identical sequences K3XPK1
Si003828m|PACid:19676252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]