SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si003863m|PACid:19676316 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si003863m|PACid:19676316
Domain Number 1 Region: 14-63
Classification Level Classification E-value
Superfamily F-box domain 0.000000000916
Family F-box domain 0.012
Further Details:      
 
Weak hits

Sequence:  Si003863m|PACid:19676316
Domain Number - Region: 217-262,290-412
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.000575
Family Galactose oxidase, central domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si003863m|PACid:19676316
Sequence length 433
Sequence
MAVGKRKRNDPAAAYLSDDLVIEILARLQERPLRRFKCVSRTWRDLISGPIHRRRLARTD
AASGFFYHACASGSWATNLSFAALCPPEGGGCFDQAFPFLPYGTQVKLLDSCNGLLLLRC
CHGAYDDVAAPRYIVCNPATHGWAVELPVPSPEPTRDPDPIELRLEEISRRRRERPLEQQ
WRQRPPRPAALAFDPAVSSHFHVFELVEDDGQHSSQYGGCTIKAVRIYSSETGEWVRRDS
AWSYRIAYAGENAYLSSEWSYRLAYAGKHAYLNGFLHLTTTDAEKGGVVVAAVDTMGKTW
RVTRVCPDPPATLGAPGVVGQSQHRLLYVDASGSGNPRELSVYALEYCSGGGERWSLKHR
TRSLDPSGQMWFGKRYHNVVAIHPGCNVIFLFDSGRQSLIAYDMDRETTRVVHTFTDAPS
NCHFFPYVPLYLQ
Download sequence
Identical sequences K3XPN5
XP_004972348.1.39314 Si003863m|PACid:19676316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]