SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si003900m|PACid:19674308 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si003900m|PACid:19674308
Domain Number 1 Region: 62-106
Classification Level Classification E-value
Superfamily F-box domain 0.00000000314
Family F-box domain 0.0098
Further Details:      
 
Domain Number 2 Region: 194-391
Classification Level Classification E-value
Superfamily RNI-like 0.0000000241
Family 28-residue LRR 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si003900m|PACid:19674308
Sequence length 392
Sequence
MAATLADAEGEGHDGRDSFRISDLICDHDDDDLISFVLCCCPLPTVTTAATLADAEGEGR
DGRDRTNDLTDDLLRQVVSHLPIRDAVRTTTLSTRWRHIWHSAPLVLFDQHISAATEAQH
VAAISSILASHTGPRIRTAHLTGFNFHDRKPELAQWARILAEKDVEDLVLITRPRVGFGN
ALITSTFGYPGLDLPADILLRCKKLRRLYLGYWAFPKITNLPGGVGVFPDLEELAILNTY
TKDNDLDHMLASCPALKKLALVLNYLKPEHVRLRGKELECAIVCSSVADVALEAKCLKRL
IMWDMWAPDLAIRIAGDVPALKVLGYLDAGCHQLQFGGVQVQAGTNASPMRRVPSVKILA
IRVDFSEFRQVQKLPSFLGCFPNIEILHVEGI
Download sequence
Identical sequences K3XPS1
Si003900m|PACid:19674308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]