SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si003908m|PACid:19674963 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si003908m|PACid:19674963
Domain Number 1 Region: 114-376
Classification Level Classification E-value
Superfamily RNI-like 0.000000000000178
Family 28-residue LRR 0.039
Further Details:      
 
Domain Number 2 Region: 12-73
Classification Level Classification E-value
Superfamily F-box domain 0.00000000366
Family F-box domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si003908m|PACid:19674963
Sequence length 577
Sequence
MESTDDQGMDSGIDRISLLPTEILHNILSVVRIRTVVRMRRLSMRWRQVCEALQFICLTR
REFRSWRADKFARFVNNLLLLRERVDLHTFQLHWCGRSPLDCNDVRMWIGYAVKHNVKVL
DVALEAYDQDSLPRCVFVCPFLEELNLQLGDTSYGHVGLVLPDKISLPSLKKLTLYDVEV
SQLSLDRIIACSPGLEDLSFTNCARYFKLIDSKILKRLTLDGFIDGGDGFTIATPCLIHF
ECSGCALECICWRERPSLESAHIDSCGPTFDGQSDFTGILLCAKTLTLLNFQGSDMKVML
EKQLPACSVFENLETLEIGDWCLTDNFNIVLCFLQLSPRLKRLTLVQRKLPEEANGVKVD
AVPINGMTLQCPLLETVVIRCSKDDREIHKMVNAMVANGVSLEKINVKFYEVLVEKVIAE
IIRSRHEQEKEFAIFEKTMEENPEWVDDSIYARSDSNNNNNEEGIEDEEDDEWEDEDDEE
SEVKDEEVDEWEDEDDDESEDEDDEESEVEDDDLEEDGVLDNNEDGNNNGMNGNGVDNNV
DGNDGNLEDGINNNEDGNDNGLEEDGIDDNEFDDDDF
Download sequence
Identical sequences K3XPS9
Si003908m|PACid:19674963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]