SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si003933m|PACid:19673559 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si003933m|PACid:19673559
Domain Number - Region: 70-111
Classification Level Classification E-value
Superfamily F-box domain 0.000916
Family F-box domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si003933m|PACid:19673559
Sequence length 428
Sequence
MAKRVPSRAQILSRQVKRRPSDLVDPPHPSSIKPSWGLKKARTASSGTTDWANLGDGPAG
LIAELVLAKDVADYVRFRAVCRPWRRCSLDPRSQGCLDGRYHPRQWIMLDKAHAGPRLRR
FLNISSGECIRMDLPALEEHTLLSLTPEGLLLLLHEATLAVRLLNPLTQQVTDLPPLTAL
LTTELQLARRFGWRLGGSISVCGAGVVADASAVAVSFCSPMELVVAKPGDERWTSVDNGF
FRSTMTIAGRFYCATRSGVMVLDGSSDQQQPPSLLTAVDWSGSLCFYRMKDSLHLVDNGG
DLMLVHRMLRRRRLDDERYARKYEAYKVDVDAGVLIPAKSFGGRAVFMGMYRTLSLSRKT
FPHVAADTLYLGSDCLDRTVSYNLADGSSWERWDRDTDATTNQVEAMRAPNIVDCLSYCI
GGTGNELA
Download sequence
Identical sequences K3XPV4
Si003933m|PACid:19673559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]