SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si003980m|PACid:19675931 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si003980m|PACid:19675931
Domain Number 1 Region: 7-61
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000706
Family F-box domain 0.0092
Further Details:      
 
Domain Number 2 Region: 268-385
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0000126
Family YVTN repeat 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si003980m|PACid:19675931
Sequence length 401
Sequence
MSVRKRKRDPAAYLSDDLIVEILARLPERPLRRSKCVCRSWCDLISGPVHRRRLAHTDAA
SGFFYHANADGSWAPVTDLKFTGLCRPPVEGGVSPTPPLLDQEFAFLPPSYTRTHVELLD
SCNGLLLLRYYDASDELAAAVYIVCNPSTQDYVELPPLPLPEASHVHDVIGGGAAAIAAV
DHLLQLEQERRQRLPRPAALTFDPAVSSHFHVFELEEERSPVFPEYSPFVTAVRIYSSET
RRWVVRRSGWNYHVAYSGEHAYLNGFLHLATTDTENGVVAAVDTEGQTWTPTRPRLLYAD
AGSGHARELSVYALEDCGGGAGRWVLKHRTRSLDPSGKVWFGKQHRLVAIHPDCNVVFLF
DSRRRSLIAYDMDRGTTRVVHTFTVATGKHHFFPYIPLYLQ
Download sequence
Identical sequences K3XQ00
Si003980m|PACid:19675931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]