SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si003985m|PACid:19676190 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si003985m|PACid:19676190
Domain Number 1 Region: 26-89
Classification Level Classification E-value
Superfamily F-box domain 0.000000000837
Family F-box domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si003985m|PACid:19676190
Sequence length 431
Sequence
MAGERSPAQLPPAKRRKKSSPTTTSSTTIHSLTDDLLLRIFLRLPSLATLVRAALACRPW
CRAVASSPAFRRRFRELHPAPLLGLFFGPPTAVQDPLLPAFPSFVPARRRDRDLGAALRG
GDFFLTSIQEHPDKAHSWDILDCRGGYVLLCNGDQFSAQAMAVVNPLARQSQRFFDDSPK
DASEGCRGTPVERSACLLCSDEDPTSFRVVALTHDESRVRATVFSSDTGEWKIHPWVDVP
GRPRRSKVWLLNGNMQSNGFLYWVYKNHKYIITLNTATMRFSVEELPQFLKNRCCSFDVG
ETNSGERCIVYAVDFTIGVMLRRTDSDGVEKWMLYRATPLDTQLDGVLRKLKGNYNELLV
VAVRDGFAYLATSKNVYDPQNPSWFLSLCLETMKLENLFQRPYNSGGHPYVMAWPPCLVR
NYGRLALEDGT
Download sequence
Identical sequences K3XQ05
XP_004969090.1.39314 Si003985m|PACid:19676190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]