SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si004017m|PACid:19675581 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si004017m|PACid:19675581
Domain Number 1 Region: 138-249,352-387
Classification Level Classification E-value
Superfamily RNI-like 0.00000000392
Family Cyclin A/CDK2-associated p19, Skp2 0.033
Further Details:      
 
Domain Number 2 Region: 31-95
Classification Level Classification E-value
Superfamily F-box domain 0.00000124
Family F-box domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si004017m|PACid:19675581
Sequence length 486
Sequence
MEAQQPTPPAKKVKPSPPRTDAEAGAAGDGEDRFSALDDDALREILARLPLRDAAVTTAL
SRRWPRVFATLPRLRLDSTTFNARASLGIDYCDDNCRWVDSLDCVLAGREAPVVAFEVDV
DIDLLEGYGDWFYSSFREVCRRGALRELRVVNDHVHERYLLPSPVYACETLTSLDLDSCW
LRVPGKLTGLRAVRSLRLRNVVAEDADLRRVISRCRAVERLVLDDCHRARNVVIRGPSLK
ELEIRSYRPLRVKVTKAPGLESAKLILFYDFPDCFWNSYDNSDGEIARKRPDGNKVQELF
DFEAMQKREHKKTDEATNIMTFLSGLGCAKELFLNLSYEFAKLSLGLNHNDRGLAKVVSC
LLNSSPNLSDLEIHDPYNYDDRRVSSLAPEFWEEHVSTECVQNHLSNITFYRASESFQDC
PYIVFSKFLVMRARALKRMSIKYQRSKDHHLYADELETVRGELQQCPRASPGALVEISAV
DRLPWY
Download sequence
Identical sequences K3XQ37
Si004017m|PACid:19675581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]