SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si004065m|PACid:19677094 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si004065m|PACid:19677094
Domain Number 1 Region: 10-79
Classification Level Classification E-value
Superfamily F-box domain 0.000000000209
Family F-box domain 0.006
Further Details:      
 
Domain Number 2 Region: 157-284,323-353
Classification Level Classification E-value
Superfamily RNI-like 0.0000000549
Family 28-residue LRR 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si004065m|PACid:19677094
Sequence length 377
Sequence
MQGVPPCQPGDISGGSQDAAPLFELDKLPEDILCHILSLLPLPDAARAACVSHRCLRSWR
CFPNLTFNQKTFGLKLNEGTSYARAKKLVDRIDHIIQNHSGIGVKTLKLDVRCCAKVITA
GHLDSWLQATIRSGILDISVELPQHLMLDYNPPCSLLSCAGSSLQSISLFSCAFHPTLRI
GCLKSLKSVCLNLVHTTGEEIQCLFSSAISLEYIELTNCNETTFLIIPSHLQELSTLKTF
KMPVLPGKFLHLKRLKIYFCGTGYDYFSLVFFLEACPALETFFLSTGEYVFGRQDTIPQD
FNADSLHIRRIPGFHHASLKKVSINQFFSSKSLIELTCQIVENTSSLRYLVLDTTSGFDT
RGTSSWQAQSYRLQSSL
Download sequence
Identical sequences K3XQ85
Si004065m|PACid:19677094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]