SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si004068m|PACid:19673608 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si004068m|PACid:19673608
Domain Number 1 Region: 17-84
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000929
Family F-box domain 0.0041
Further Details:      
 
Weak hits

Sequence:  Si004068m|PACid:19673608
Domain Number - Region: 181-383
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0706
Family Methylamine dehydrogenase, H-chain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si004068m|PACid:19673608
Sequence length 427
Sequence
MAAAAVTRRRKSTDGGGIAALPDELLLEVFSRVGNVKALFLFAVTSRRWLRLFTDPAFLR
ELCPGHGEGRRARLLGFVPRQAKLHRALTSFVANDDGTFNYAQPLAARHGILLRHIVVNR
GSCCIRRKPDIHCRLLDPVTGAHDDVAPPLECACVNHANGYAILTAADGDHINREQRPPS
SAPHPAFSGELLLVGSHLDNNRLRQHVHSFSGATRRWSAPAQIRHHNRLRMVGARAAVVP
RGAAHWLRRDLYLLSASTATGRASASVTKLAIKAAGGVPYLCVRRDGRFSLARVHPTRVD
VWTQPDGDDGGDMVAWLRAQFYGKEWLLSQVIQMPAAAVPAGANFMCCSWFQFSKGAMMA
VYGGSGVFVLNLETKAIEKIMDLTWCDPSRGYYSCLPYEMDPPEFFVGRLGGRAMETEEQ
AGLTMRD
Download sequence
Identical sequences K3XQ88
Si004068m|PACid:19673608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]