SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si004096m|PACid:19676964 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si004096m|PACid:19676964
Domain Number - Region: 5-45
Classification Level Classification E-value
Superfamily F-box domain 0.0283
Family F-box domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si004096m|PACid:19676964
Sequence length 364
Sequence
MEGSNDWGSLPWLILERVAGADNLTDPKDFVHIRSVCPKWRDAIRPIRPTAHGLFQPPIM
VTEGPPDEDYSGRVLFHSVSSDESHLIQLTALQGKRVAGSGAGLLIGIDQRDDLSGVLVN
PLTGKSTALPRLPDCFHGGVSPPAVEVVVVVVWVWAPGRGPTVALWRRGSDDGWATTHDA
DPGRFWASLPQHWNRLVTHGPQVLEGELAAAADEEKELANGGTAFLPGSKAVYLVEHEGK
VRFLFEYYGYNPEMPAGKRVNFALNDMVGDGMANVDWADAPELQDKAIFRSGKDGACYVI
PASDDLGLSKNSVYYFDWRHLEEAEDGGGRTEAFCLCKVDMLEGVDTIVKQVPNPKCRAW
ETTT
Download sequence
Identical sequences K3XQB3
Si004096m|PACid:19676964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]