SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si004213m|PACid:19677956 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si004213m|PACid:19677956
Domain Number 1 Region: 8-43
Classification Level Classification E-value
Superfamily F-box domain 0.0000119
Family F-box domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si004213m|PACid:19677956
Sequence length 318
Sequence
MTSPIAQLCELPTELWGEIISRIDVLDVMSFSSTCKSLELVCKTLGATIPKSGTAMLVTS
QPDPDGWGVDDDLRIGKFGLHDVCNALSFCCVIEDLQRRICLGGKGDWLVTTNTGLDWEI
LNPMTRSKVPLLSLANNLSGIELPSYRKFSVVFPPFTRDVRRVVLSRTPSHADGYEAIAL
FSDGLLTYTTQGENVWRVLKNPTDRDDSGNNYYPEVFLDVIVYHGYVIAVEENGDIDDME
KDFIHWEDLVVIPWAKLPFFITSTEFKCNIIYMADVGEYDVAICSLDFPVDKKEHLLKAW
TIRTPMWFRPSAHAKGNH
Download sequence
Identical sequences K3XQM6
Si004213m|PACid:19677956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]